NR1H2 antibody (70R-1007)

Rabbit polyclonal NR1H2 antibody raised against the middle region of NR1H2

Synonyms Polyclonal NR1H2 antibody, Anti-NR1H2 antibody, RIP15 antibody, LXR-b antibody, UNR antibody, NRH2-1 antibody, NER antibody, NR1H2, LXRB antibody, Nuclear Receptor Subfamily 1 Group H Member 2 antibody, NRH2-1, NER-I antibody, NRH2 1 antibody, NRH2 1
Specificity NR1H2 antibody was raised against the middle region of NR1H2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen NR1H2 antibody was raised using the middle region of NR1H2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI
Assay Information NR1H2 Blocking Peptide, catalog no. 33R-6119, is also available for use as a blocking control in assays to test for specificity of this NR1H2 antibody


Western blot analysis using NR1H2 antibody (70R-1007)

Recommended NR1H2 Antibody Titration: 1.25ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NR1H2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR1H2 antibody (70R-1007) | Recommended NR1H2 Antibody Titration: 1.25ug/ml

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors