NR2F6 antibody (70R-1929)

Rabbit polyclonal NR2F6 antibody raised against the N terminal of NR2F6

Synonyms Polyclonal NR2F6 antibody, Anti-NR2F6 antibody, Nuclear Receptor Subfamily 2 Group F Member 6 antibody, NRF6-2 antibody, NRF6-2, EAR2 antibody, ERBAL2 antibody, NR2F6, NRF6 2, NRF6 2 antibody, EAR-2 antibody
Specificity NR2F6 antibody was raised against the N terminal of NR2F6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Assay Information NR2F6 Blocking Peptide, catalog no. 33R-1199, is also available for use as a blocking control in assays to test for specificity of this NR2F6 antibody


Western blot analysis using NR2F6 antibody (70R-1929)

Recommended NR2F6 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR2F6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR2F6 antibody (70R-1929) | Recommended NR2F6 Antibody Titration: 0.2-1 ug/ml
  • Immunofluorescent staining using NR2F6 antibody (70R-1929) | Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue; Observed Staining: Nucleus in hepatocytes stained with NR2F6 antibody at 1:100

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors