NR5A1 antibody (70R-1005)

Affinity purified Rabbit polyclonal NR5A1 antibody raised against the middle region of NR5A1

Synonyms Polyclonal NR5A1 antibody, Anti-NR5A1 antibody, Nuclear Receptor Subfamily 5 Group A Member 1 antibody, NRA1 5 antibody, FTZF1 antibody, NR5A1, SF1 antibody, ELP antibody, NRA1-5, NRA1 5, NRA1-5 antibody, FTZ1 antibody, SF-1 antibody, AD4BP antibody
Specificity NR5A1 antibody was raised against the middle region of NR5A1
Cross Reactivity Human
Applications WB
Immunogen NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
Assay Information NR5A1 Blocking Peptide, catalog no. 33R-5322, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody

Images

Western blot analysis using NR5A1 antibody (70R-1005)

Recommended NR5A1 Antibody

Specifications

Host Rabbit
Method of Purification Affinity Purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR5A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using NR5A1 antibody (70R-1005) | Recommended NR5A1 Antibody

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors