NR5A1 antibody (70R-1934)

Rabbit polyclonal NR5A1 antibody raised against the middle region of NR5A1

Synonyms Polyclonal NR5A1 antibody, Anti-NR5A1 antibody, AD4BP antibody, NRA1-5 antibody, NR5A1, Nuclear Receptor Subfamily 5 Group A Member 1 antibody, ELP antibody, SF-1 antibody, NRA1 5 antibody, FTZF1 antibody, NRA1-5, FTZ1 antibody, SF1 antibody, NRA1 5
Specificity NR5A1 antibody was raised against the middle region of NR5A1
Cross Reactivity Human
Applications WB
Immunogen NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA
Assay Information NR5A1 Blocking Peptide, catalog no. 33R-8589, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody


Western blot analysis using NR5A1 antibody (70R-1934)

Recommended NR5A1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR5A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR5A1 antibody (70R-1934) | Recommended NR5A1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors