NRCAM Blocking Peptide (33R-6774)
A synthetic peptide for use as a blocking control in assays to test for specificity of NRCAM antibody, catalog no. 70R-1741
Overview
Overview
| Synonyms | NRCAM control peptide, NRCAM antibody Blocking Peptide, Anti-NRCAM Blocking Peptide, Neuronal Cell Adhesion Molecule Blocking Peptide, KIAA0343 Blocking Peptide, MGC138845 Blocking Peptide, MGC138846 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP |
|---|---|
| Molecular Weight | 141 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product