NRCAM Blocking Peptide (33R-6774)

A synthetic peptide for use as a blocking control in assays to test for specificity of NRCAM antibody, catalog no. 70R-1741

Synonyms NRCAM control peptide, NRCAM antibody Blocking Peptide, Anti-NRCAM Blocking Peptide, Neuronal Cell Adhesion Molecule Blocking Peptide, KIAA0343 Blocking Peptide, MGC138845 Blocking Peptide, MGC138846 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
Molecular Weight 141 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors