NSDHL antibody (70R-1783)

Rabbit polyclonal NSDHL antibody

Synonyms Polyclonal NSDHL antibody, Anti-NSDHL antibody, H105E3 antibody, Nad antibody, P Dependent Steroid Dehydrogenase-Like antibody, XAP104 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
Assay Information NSDHL Blocking Peptide, catalog no. 33R-7828, is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody


Western Blot analysis using NSDHL antibody (70R-1783)

NSDHL antibody (70R-1783) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NSDHL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NSDHL antibody (70R-1783) | NSDHL antibody (70R-1783) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors