NT5DC1 antibody (70R-3114)

Rabbit polyclonal NT5DC1 antibody raised against the N terminal of NT5DC1

Synonyms Polyclonal NT5DC1 antibody, Anti-NT5DC1 antibody, C6orf200 antibody, LP2642 antibody, NTDC1-5 antibody, NT5C2L1 antibody, NTDC1 5, 5'-Nucleotidase Domain Containing 1 antibody, NTDC1-5, MGC24302 antibody, MGC131837 antibody, NT5DC1, NTDC1 5 antibody
Specificity NT5DC1 antibody was raised against the N terminal of NT5DC1
Cross Reactivity Human,Mouse
Applications WB
Immunogen NT5DC1 antibody was raised using the N terminal of NT5DC1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF
Assay Information NT5DC1 Blocking Peptide, catalog no. 33R-2811, is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Images

Western Blot analysis using NT5DC1 antibody (70R-3114)

NT5DC1 antibody (70R-3114) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NT5DC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NT5DC1 antibody (70R-3114) | NT5DC1 antibody (70R-3114) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors