Nucleobindin 1 antibody (70R-1581)

Rabbit polyclonal Nucleobindin 1 antibody raised against the C terminal of NUCB1

Synonyms Polyclonal Nucleobindin 1 antibody, Anti-Nucleobindin 1 antibody, Nucleobindin -1 antibody, Nucleobindin 1 antibody, Nucleobindin 1, NUCB1 antibody, Nucleobindin 1, Nucleobindin -1
Specificity Nucleobindin 1 antibody was raised against the C terminal of NUCB1
Cross Reactivity Human
Applications WB
Immunogen Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Images

Western blot analysis using Nucleobindin 1 antibody (70R-1581)

Tissue analyzed: HepG2 lysates; Antibody Dilution: 1.0ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUCB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Nucleobindin 1 antibody (70R-1581) | Tissue analyzed: HepG2 lysates; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors