Nucleobindin 1 antibody (70R-5407)

Rabbit polyclonal Nucleobindin 1 antibody raised against the C terminal of NUCB1

Synonyms Polyclonal Nucleobindin 1 antibody, Anti-Nucleobindin 1 antibody, NUCB1 antibody, Nucleobindin -1 antibody, Nucleobindin 1 antibody, Nucleobindin -1, Nucleobindin 1, Nucleobindin 1
Specificity Nucleobindin 1 antibody was raised against the C terminal of NUCB1
Cross Reactivity Human
Applications WB
Immunogen Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Assay Information Nucleobindin 1 Blocking Peptide, catalog no. 33R-6951, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody


Western Blot analysis using Nucleobindin 1 antibody (70R-5407)

Nucleobindin 1 antibody (70R-5407) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUCB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Nucleobindin 1 antibody (70R-5407) | Nucleobindin 1 antibody (70R-5407) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors