NUDT17 antibody (70R-2133)

Rabbit polyclonal NUDT17 antibody

Synonyms Polyclonal NUDT17 antibody, Anti-NUDT17 antibody, NUDT-17 antibody, FLJ34433 antibody, Nucleoside Diphosphate Linked Moiety X-Type Motif 17 antibody, NUDT 17 antibody, NUDT 17, Nudix 17 antibody, NUDT-17, NUDT17
Cross Reactivity Human
Applications WB
Immunogen NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD
Assay Information NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody


Western Blot analysis using NUDT17 antibody (70R-2133)

NUDT17 antibody (70R-2133) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUDT17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUDT17 antibody (70R-2133) | NUDT17 antibody (70R-2133) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors