NUP35 antibody (70R-2173)

Rabbit polyclonal NUP35 antibody raised against the C terminal of NUP35

Synonyms Polyclonal NUP35 antibody, Anti-NUP35 antibody, NUP-35, NP44 antibody, Nucleoporin 35Kda antibody, NUP 35 antibody, NUP35, NUP-35 antibody, MP44 antibody, NUP 35
Specificity NUP35 antibody was raised against the C terminal of NUP35
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW
Assay Information NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody


Western Blot analysis using NUP35 antibody (70R-2173)

NUP35 antibody (70R-2173) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUP35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUP35 antibody (70R-2173) | NUP35 antibody (70R-2173) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors