NUP98 antibody (70R-5608)

Rabbit polyclonal NUP98 antibody raised against the N terminal of NUP98

Synonyms Polyclonal NUP98 antibody, Anti-NUP98 antibody, NUP 98 antibody, NUP196 antibody, NUP 98, ADIR2 antibody, NUP-98, NUP-98 antibody, NUP98, Nucleoporin 98Kda antibody
Specificity NUP98 antibody was raised against the N terminal of NUP98
Cross Reactivity Human,Rat
Applications WB
Immunogen NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
Assay Information NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody


Western Blot analysis using NUP98 antibody (70R-5608)

NUP98 antibody (70R-5608) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUP98 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUP98 antibody (70R-5608) | NUP98 antibody (70R-5608) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors