NUSAP1 antibody (70R-2155)

Rabbit polyclonal NUSAP1 antibody raised against the middle region of NUSAP1

Synonyms Polyclonal NUSAP1 antibody, Anti-NUSAP1 antibody, Nucleolar And Spindle Associated Protein 1 antibody, BM037 antibody, SAPL antibody, ANKT antibody, NUSAP 1, NUSAP 1 antibody, NUSAP-1, Q0310 antibody, NUSAP1, FLJ13421 antibody, NUSAP-1 antibody, LNP antibody, PRO0310p1 antibody
Specificity NUSAP1 antibody was raised against the middle region of NUSAP1
Cross Reactivity Human
Applications WB
Immunogen NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
Assay Information NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody


Western Blot analysis using NUSAP1 antibody (70R-2155)

NUSAP1 antibody (70R-2155) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUSAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUSAP1 antibody (70R-2155) | NUSAP1 antibody (70R-2155) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors