NUSAP1 antibody (70R-2411)

Rabbit polyclonal NUSAP1 antibody raised against the C terminal of NUSAP1

Synonyms Polyclonal NUSAP1 antibody, Anti-NUSAP1 antibody, BM037 antibody, LNP antibody, PRO0310p1 antibody, ANKT antibody, NUSAP-1 antibody, SAPL antibody, NUSAP1, Q0310 antibody, NUSAP 1, NUSAP 1 antibody, NUSAP-1, Nucleolar And Spindle Associated Protein 1 antibody, FLJ13421 antibody
Specificity NUSAP1 antibody was raised against the C terminal of NUSAP1
Cross Reactivity Human
Applications WB
Immunogen NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
Assay Information NUSAP1 Blocking Peptide, catalog no. 33R-5074, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody


Western Blot analysis using NUSAP1 antibody (70R-2411)

NUSAP1 antibody (70R-2411) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUSAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUSAP1 antibody (70R-2411) | NUSAP1 antibody (70R-2411) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors