OAT Blocking Peptide (33R-8230)

A synthetic peptide for use as a blocking control in assays to test for specificity of OAT antibody, catalog no. 70R-5318

Synonyms OAT control peptide, OAT antibody Blocking Peptide, Anti-OAT Blocking Peptide, Ornithine Aminotransferase Blocking Peptide, Gyrate Atrophy Blocking Peptide, DKFZp781A11155 Blocking Peptide, HOGA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors