OAT Blocking Peptide (33R-8230)
A synthetic peptide for use as a blocking control in assays to test for specificity of OAT antibody, catalog no. 70R-5318
Overview
Overview
| Synonyms | OAT control peptide, OAT antibody Blocking Peptide, Anti-OAT Blocking Peptide, Ornithine Aminotransferase Blocking Peptide, Gyrate Atrophy Blocking Peptide, DKFZp781A11155 Blocking Peptide, HOGA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV |
|---|---|
| Molecular Weight | 45 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product