Occludin antibody (70R-1721)

Rabbit polyclonal Occludin antibody raised against the N terminal of OCLN

Synonyms Polyclonal Occludin antibody, Anti-Occludin antibody, OCLN antibody
Specificity Occludin antibody was raised against the N terminal of OCLN
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
Assay Information Occludin Blocking Peptide, catalog no. 33R-6508, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody


Western Blot analysis using Occludin antibody (70R-1721)

Occludin antibody (70R-1721) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of OCLN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Occludin antibody (70R-1721) | Occludin antibody (70R-1721) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors