OCIAD2 antibody (70R-3678)

Rabbit polyclonal OCIAD2 antibody raised against the middle region of OCIAD2

Synonyms Polyclonal OCIAD2 antibody, Anti-OCIAD2 antibody, OCIAD 2 antibody, OCIAD-2 antibody, OCIAD2, Ocia Domain Containing 2 antibody, OCIAD 2, OCIAD-2, DKFZp686C03164 antibody, MGC45416 antibody
Specificity OCIAD2 antibody was raised against the middle region of OCIAD2
Cross Reactivity Human
Applications WB
Immunogen OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG
Assay Information OCIAD2 Blocking Peptide, catalog no. 33R-7576, is also available for use as a blocking control in assays to test for specificity of this OCIAD2 antibody

Images

Western Blot analysis using OCIAD2 antibody (70R-3678)

OCIAD2 antibody (70R-3678) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OCIAD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of OCIAD2 is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OCIAD2 antibody (70R-3678) | OCIAD2 antibody (70R-3678) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors