ODF2 Blocking Peptide (33R-6401)
A synthetic peptide for use as a blocking control in assays to test for specificity of ODF2 antibody, catalog no. 70R-3915
Overview
Overview
| Synonyms | ODF2 control peptide, ODF2 antibody Blocking Peptide, Anti-ODF2 Blocking Peptide, Outer Dense Fiber Of Sperm Tails 2 Blocking Peptide, FLJ44866 Blocking Peptide, MGC111096 Blocking Peptide, MGC9034 Blocking Peptide, ODF2/1 Blocking Peptide, ODF2/2 Blocking Peptide, ODF84 Blocking Peptide, ODF2, ODF-2, ODF 2, ODF-2 Blocking Peptide, ODF 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product