ODF2 Blocking Peptide (33R-6401)

A synthetic peptide for use as a blocking control in assays to test for specificity of ODF2 antibody, catalog no. 70R-3915

Synonyms ODF2 control peptide, ODF2 antibody Blocking Peptide, Anti-ODF2 Blocking Peptide, Outer Dense Fiber Of Sperm Tails 2 Blocking Peptide, FLJ44866 Blocking Peptide, MGC111096 Blocking Peptide, MGC9034 Blocking Peptide, ODF2/1 Blocking Peptide, ODF2/2 Blocking Peptide, ODF84 Blocking Peptide, ODF2, ODF-2, ODF 2, ODF-2 Blocking Peptide, ODF 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors