ODF2L antibody (70R-4299)

Rabbit polyclonal ODF2L antibody raised against the N terminal of ODF2L

Synonyms Polyclonal ODF2L antibody, Anti-ODF2L antibody, Outer Dense Fiber Of Sperm Tails 2-Like antibody, ODF2L, dJ977L11.1 antibody, ODFL-2, KIAA1229 antibody, ODFL 2, RP5-977L11.1 antibody, ODFL-2 antibody, MGC111060 antibody, ODFL 2 antibody
Specificity ODF2L antibody was raised against the N terminal of ODF2L
Cross Reactivity Human,Rat
Applications WB
Immunogen ODF2L antibody was raised using the N terminal of ODF2L corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH
Assay Information ODF2L Blocking Peptide, catalog no. 33R-4698, is also available for use as a blocking control in assays to test for specificity of this ODF2L antibody


Western Blot analysis using ODF2L antibody (70R-4299)

ODF2L antibody (70R-4299) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ODF2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ODF2L protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ODF2L antibody (70R-4299) | ODF2L antibody (70R-4299) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors