ODF3L1 antibody (70R-3318)

Rabbit polyclonal ODF3L1 antibody raised against the N terminal of ODF3L1

Synonyms Polyclonal ODF3L1 antibody, Anti-ODF3L1 antibody, ODFL1-3 antibody, ODFL1-3, Outer Dense Fiber Of Sperm Tails 3-Like 1 antibody, ODF3L1, ODFL1 3 antibody, ODFL1 3, MGC48986 antibody
Specificity ODF3L1 antibody was raised against the N terminal of ODF3L1
Cross Reactivity Human
Applications WB
Immunogen ODF3L1 antibody was raised using the N terminal of ODF3L1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC
Assay Information ODF3L1 Blocking Peptide, catalog no. 33R-4527, is also available for use as a blocking control in assays to test for specificity of this ODF3L1 antibody


Western Blot analysis using ODF3L1 antibody (70R-3318)

ODF3L1 antibody (70R-3318) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ODF3L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ODF3L1 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ODF3L1 antibody (70R-3318) | ODF3L1 antibody (70R-3318) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors