OGDH Blocking Peptide (33R-5994)
A synthetic peptide for use as a blocking control in assays to test for specificity of OGDH antibody, catalog no. 70R-3029
Overview
Overview
| Synonyms | OGDH control peptide, OGDH antibody Blocking Peptide, Anti-OGDH Blocking Peptide, Oxoglutarate Blocking Peptide, Alpha Ketoglutarate Dehydrogenase Blocking Peptide, AKGDH Blocking Peptide, E1k Blocking Peptide, OGDC Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product