OGDH Blocking Peptide (33R-5994)

A synthetic peptide for use as a blocking control in assays to test for specificity of OGDH antibody, catalog no. 70R-3029

Synonyms OGDH control peptide, OGDH antibody Blocking Peptide, Anti-OGDH Blocking Peptide, Oxoglutarate Blocking Peptide, Alpha Ketoglutarate Dehydrogenase Blocking Peptide, AKGDH Blocking Peptide, E1k Blocking Peptide, OGDC Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors