OPA3 Blocking Peptide (33R-8892)

A synthetic peptide for use as a blocking control in assays to test for specificity of OPA3 antibody, catalog no. 70R-9898

Synonyms OPA3 control peptide, OPA3 antibody Blocking Peptide, Anti-OPA3 Blocking Peptide, optic atrophy 3, autosomal recessive, with chorea and spastic paraplegia Blocking Peptide, FLJ22187 Blocking Peptide, FLJ25932 Blocking Peptide, MGA3 Blocking Peptide, MGC75494 Blocking Peptide, OPA3, OPA-3, OPA 3, OPA-3 Blocking Peptide, OPA 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors