OPA3 Blocking Peptide (33R-8892)
A synthetic peptide for use as a blocking control in assays to test for specificity of OPA3 antibody, catalog no. 70R-9898
Overview
Overview
| Synonyms | OPA3 control peptide, OPA3 antibody Blocking Peptide, Anti-OPA3 Blocking Peptide, optic atrophy 3, autosomal recessive, with chorea and spastic paraplegia Blocking Peptide, FLJ22187 Blocking Peptide, FLJ25932 Blocking Peptide, MGA3 Blocking Peptide, MGC75494 Blocking Peptide, OPA3, OPA-3, OPA 3, OPA-3 Blocking Peptide, OPA 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product