OPN1SW Blocking Peptide (33R-8406)
A synthetic peptide for use as a blocking control in assays to test for specificity of OPN1SW antibody, catalog no. 70R-9929
Overview
Overview
| Synonyms | OPN1SW control peptide, OPN1SW antibody Blocking Peptide, Anti-OPN1SW Blocking Peptide, opsin 1, cone pigments, short-wave-sensitive Blocking Peptide, BCP Blocking Peptide, BOP Blocking Peptide, CBT Blocking Peptide, OPN1SW, OPNSW-1, OPNSW 1, OPNSW-1 Blocking Peptide, OPNSW 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product