Opticin antibody (70R-5283)

Rabbit polyclonal Opticin antibody raised against the C terminal of OPTC

Synonyms Polyclonal Opticin antibody, Anti-Opticin antibody, OPT antibody, OPTC antibody
Specificity Opticin antibody was raised against the C terminal of OPTC
Cross Reactivity Human
Applications WB
Immunogen Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED
Assay Information Opticin Blocking Peptide, catalog no. 33R-5414, is also available for use as a blocking control in assays to test for specificity of this Opticin antibody


Western Blot analysis using Opticin antibody (70R-5283)

Opticin antibody (70R-5283) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OPTC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Opticin antibody (70R-5283) | Opticin antibody (70R-5283) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors