OSBPL3 Blocking Peptide (33R-6237)
A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL3 antibody, catalog no. 70R-2890
Overview
Overview
| Synonyms | OSBPL3 control peptide, OSBPL3 antibody Blocking Peptide, Anti-OSBPL3 Blocking Peptide, Oxysterol Binding Protein-Like 3 Blocking Peptide, DKFZp667P1518 Blocking Peptide, KIAA0704 Blocking Peptide, MGC21526 Blocking Peptide, ORP-3 Blocking Peptide, ORP3 Blocking Peptide, OSBP3 Blocking Peptide, OSBPL3, OSBPL-3, OSBPL 3, OSBPL-3 Blocking Peptide, OSBPL 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE |
|---|---|
| Molecular Weight | 98 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product