OSBPL3 Blocking Peptide (33R-6237)

A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL3 antibody, catalog no. 70R-2890

Synonyms OSBPL3 control peptide, OSBPL3 antibody Blocking Peptide, Anti-OSBPL3 Blocking Peptide, Oxysterol Binding Protein-Like 3 Blocking Peptide, DKFZp667P1518 Blocking Peptide, KIAA0704 Blocking Peptide, MGC21526 Blocking Peptide, ORP-3 Blocking Peptide, ORP3 Blocking Peptide, OSBP3 Blocking Peptide, OSBPL3, OSBPL-3, OSBPL 3, OSBPL-3 Blocking Peptide, OSBPL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE
Molecular Weight 98 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors