OSBPL8 Blocking Peptide (33R-8722)
A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6725
Overview
Overview
| Synonyms | OSBPL8 control peptide, OSBPL8 antibody Blocking Peptide, Anti-OSBPL8 Blocking Peptide, Oxysterol Binding Protein-Like 8 Blocking Peptide, DKFZp686A11164 Blocking Peptide, MGC126578 Blocking Peptide, MGC133203 Blocking Peptide, MST120 Blocking Peptide, MSTP120 Blocking Peptide, ORP8 Blocking Peptide, OSBP10 Blocking Peptide, OSBPL8, OSBPL-8, OSBPL 8, OSBPL-8 Blocking Peptide, OSBPL 8 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS |
|---|---|
| Molecular Weight | 97 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product