OSBPL8 Blocking Peptide (33R-8722)

A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6725

Synonyms OSBPL8 control peptide, OSBPL8 antibody Blocking Peptide, Anti-OSBPL8 Blocking Peptide, Oxysterol Binding Protein-Like 8 Blocking Peptide, DKFZp686A11164 Blocking Peptide, MGC126578 Blocking Peptide, MGC133203 Blocking Peptide, MST120 Blocking Peptide, MSTP120 Blocking Peptide, ORP8 Blocking Peptide, OSBP10 Blocking Peptide, OSBPL8, OSBPL-8, OSBPL 8, OSBPL-8 Blocking Peptide, OSBPL 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS
Molecular Weight 97 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors