OSBPL9 Blocking Peptide (33R-3831)
A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL9 antibody, catalog no. 70R-2891
Overview
Overview
| Synonyms | OSBPL9 control peptide, OSBPL9 antibody Blocking Peptide, Anti-OSBPL9 Blocking Peptide, Oxysterol Binding Protein-Like 9 Blocking Peptide, FLJ12492 Blocking Peptide, FLJ14629 Blocking Peptide, FLJ14801 Blocking Peptide, FLJ32055 Blocking Peptide, FLJ34384 Blocking Peptide, MGC15035 Blocking Peptide, ORP9 Blocking Peptide, OSBPL9, OSBPL-9, OSBPL 9, OSBPL-9 Blocking Peptide, OSBPL 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product