OSBPL9 Blocking Peptide (33R-3831)

A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL9 antibody, catalog no. 70R-2891

Synonyms OSBPL9 control peptide, OSBPL9 antibody Blocking Peptide, Anti-OSBPL9 Blocking Peptide, Oxysterol Binding Protein-Like 9 Blocking Peptide, FLJ12492 Blocking Peptide, FLJ14629 Blocking Peptide, FLJ14801 Blocking Peptide, FLJ32055 Blocking Peptide, FLJ34384 Blocking Peptide, MGC15035 Blocking Peptide, ORP9 Blocking Peptide, OSBPL9, OSBPL-9, OSBPL 9, OSBPL-9 Blocking Peptide, OSBPL 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors