OSGEP antibody (70R-3838)

Rabbit polyclonal OSGEP antibody raised against the N terminal of OSGEP

Synonyms Polyclonal OSGEP antibody, Anti-OSGEP antibody, GCPL1 antibody, FLJ20411 antibody, OSGEP1 antibody, O-Sialoglycoprotein Endopeptidase antibody, KAE1 antibody, PRSMG1 antibody
Specificity OSGEP antibody was raised against the N terminal of OSGEP
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA
Assay Information OSGEP Blocking Peptide, catalog no. 33R-7254, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody


Western Blot analysis using OSGEP antibody (70R-3838)

OSGEP antibody (70R-3838) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OSGEP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OSGEP antibody (70R-3838) | OSGEP antibody (70R-3838) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors