OSMR Blocking Peptide (33R-5130)
A synthetic peptide for use as a blocking control in assays to test for specificity of OSMR antibody, catalog no. 70R-7385
Overview
Overview
| Synonyms | OSMR control peptide, OSMR antibody Blocking Peptide, Anti-OSMR Blocking Peptide, Oncostatin M Receptor Blocking Peptide, MGC150626 Blocking Peptide, MGC150627 Blocking Peptide, MGC75127 Blocking Peptide, OSMRB Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
|---|---|
| Molecular Weight | 110 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product