OSMR Blocking Peptide (33R-5130)

A synthetic peptide for use as a blocking control in assays to test for specificity of OSMR antibody, catalog no. 70R-7385

Synonyms OSMR control peptide, OSMR antibody Blocking Peptide, Anti-OSMR Blocking Peptide, Oncostatin M Receptor Blocking Peptide, MGC150626 Blocking Peptide, MGC150627 Blocking Peptide, MGC75127 Blocking Peptide, OSMRB Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH
Molecular Weight 110 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors