OSTF1 Blocking Peptide (33R-10314)

A synthetic peptide for use as a blocking control in assays to test for specificity of OSTF1 antibody, catalog no. 70R-10362

Synonyms OSTF1 control peptide, OSTF1 antibody Blocking Peptide, Anti-OSTF1 Blocking Peptide, osteoclast stimulating factor 1 Blocking Peptide, FLJ20559 Blocking Peptide, OSF Blocking Peptide, SH3P2 Blocking Peptide, bA235O14.1 Blocking Peptide, OSTF1, OSTF-1, OSTF 1, OSTF-1 Blocking Peptide, OSTF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPLHEAAKRGNLSWLREC
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors