Otospiralin Blocking Peptide (33R-6316)
A synthetic peptide for use as a blocking control in assays to test for specificity of OTOS antibody, catalog no. 70R-4531
Overview
Overview
| Synonyms | Otospiralin control peptide, Otospiralin antibody Blocking Peptide, Anti-Otospiralin Blocking Peptide, OTOSP Blocking Peptide, OTOS Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY |
|---|---|
| Molecular Weight | 10 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OTOS may be essential for the survival of the neurosensory epithelium of the inner ear. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product