OVGP1 Blocking Peptide (33R-7639)

A synthetic peptide for use as a blocking control in assays to test for specificity of OVGP1 antibody, catalog no. 70R-10012

Synonyms OVGP1 control peptide, OVGP1 antibody Blocking Peptide, Anti-OVGP1 Blocking Peptide, oviductal glycoprotein 1, 120kDa Blocking Peptide, CHIT5 Blocking Peptide, EGP Blocking Peptide, MUC9 Blocking Peptide, OGP Blocking Peptide, OVGP1, OVGP-1, OVGP 1, OVGP-1 Blocking Peptide, OVGP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA
Molecular Weight 75 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OVGP1 is a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors