OVGP1 Blocking Peptide (33R-7639)
A synthetic peptide for use as a blocking control in assays to test for specificity of OVGP1 antibody, catalog no. 70R-10012
Overview
Overview
| Synonyms | OVGP1 control peptide, OVGP1 antibody Blocking Peptide, Anti-OVGP1 Blocking Peptide, oviductal glycoprotein 1, 120kDa Blocking Peptide, CHIT5 Blocking Peptide, EGP Blocking Peptide, MUC9 Blocking Peptide, OGP Blocking Peptide, OVGP1, OVGP-1, OVGP 1, OVGP-1 Blocking Peptide, OVGP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA |
|---|---|
| Molecular Weight | 75 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | OVGP1 is a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product