OXSM antibody (70R-2413)

Rabbit polyclonal OXSM antibody raised against the middle region of OXSM

Synonyms Polyclonal OXSM antibody, Anti-OXSM antibody, FLJ20604 antibody, FASN2D antibody, KS antibody, 3-Oxoacyl-Acp Synthase Mitochondrial antibody
Specificity OXSM antibody was raised against the middle region of OXSM
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
Assay Information OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody


Western Blot analysis using OXSM antibody (70R-2413)

OXSM antibody (70R-2413) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OXSM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OXSM is a mitochondrial beta-ketoacyl synthase (EC involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OXSM antibody (70R-2413) | OXSM antibody (70R-2413) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors