P2RX2 antibody (70R-1520)

Rabbit polyclonal P2RX2 antibody raised against the middle region of P2RX2

Synonyms Polyclonal P2RX2 antibody, Anti-P2RX2 antibody, P2RX2, PRX-2, PRX-2 antibody, Purinergic Receptor P2X Ligand-Gated Ion Channel 2 antibody, PRX 2, PRX 2 antibody
Specificity P2RX2 antibody was raised against the middle region of P2RX2
Cross Reactivity Human
Applications IHC, WB
Immunogen P2RX2 antibody was raised using the middle region of P2RX2 corresponding to a region with amino acids LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK
Assay Information P2RX2 Blocking Peptide, catalog no. 33R-5050, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody

Images

Western Blot analysis using P2RX2 antibody (70R-1520)

P2RX2 antibody (70R-1520) used at 0.6 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of P2RX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.6 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using P2RX2 antibody (70R-1520) | P2RX2 antibody (70R-1520) used at 0.6 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors