P2rx2 Blocking Peptide (33R-10318)

A synthetic peptide for use as a blocking control in assays to test for specificity of P2rx2 antibody, catalog no. 70R-8075

Synonyms P2rx2 control peptide, P2rx2 antibody Blocking Peptide, Anti-P2rx2 Blocking Peptide, purinergic receptor P2X, ligand-gated ion channel, 2 Blocking Peptide, MGC129148 Blocking Peptide, MGC129149 Blocking Peptide, P2X2a Blocking Peptide, P2x2 Blocking Peptide, P2rx2, Prx-2, Prx 2, Prx-2 Blocking Peptide, Prx 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors