P2ry1 Blocking Peptide (33R-9867)

A synthetic peptide for use as a blocking control in assays to test for specificity of P2ry1 antibody, catalog no. 70R-9082

Synonyms P2ry1 control peptide, P2ry1 antibody Blocking Peptide, Anti-P2ry1 Blocking Peptide, purinergic receptor P2Y, G-protein coupled, 1 Blocking Peptide, P2y Blocking Peptide, P2y1 Blocking Peptide, P2ry1, Pry1-2, Pry1 2, Pry1-2 Blocking Peptide, Pry1 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIP
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance P2ry1 is a G protein-coupled receptor for extracellular ATP; It plays a role in ischemic preconditioning (IPC) in heart.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors