P2ry1 Blocking Peptide (33R-9867)
A synthetic peptide for use as a blocking control in assays to test for specificity of P2ry1 antibody, catalog no. 70R-9082
Overview
Overview
| Synonyms | P2ry1 control peptide, P2ry1 antibody Blocking Peptide, Anti-P2ry1 Blocking Peptide, purinergic receptor P2Y, G-protein coupled, 1 Blocking Peptide, P2y Blocking Peptide, P2y1 Blocking Peptide, P2ry1, Pry1-2, Pry1 2, Pry1-2 Blocking Peptide, Pry1 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIP |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | P2ry1 is a G protein-coupled receptor for extracellular ATP; It plays a role in ischemic preconditioning (IPC) in heart. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product