P450 Blocking Peptide (33R-3924)
A synthetic peptide for use as a blocking control in assays to test for specificity of POR antibody, catalog no. 70R-1780
Overview
Overview
| Synonyms | P450 control peptide, P450 antibody Blocking Peptide, Anti-P450 Blocking Peptide, CPR Blocking Peptide, CYPOR Blocking Peptide, DKFZp686G04235 Blocking Peptide, FLJ26468 Blocking Peptide, P450R Blocking Peptide, Cytochrome Oxidoreductase Blocking Peptide, POR Blocking Peptide, P450, P-450, P 450, P-450 Blocking Peptide, P 450 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT |
|---|---|
| Molecular Weight | 77 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product