P450 Blocking Peptide (33R-9882)

A synthetic peptide for use as a blocking control in assays to test for specificity of POR antibody, catalog no. 70R-6687

Synonyms P450 control peptide, P450 antibody Blocking Peptide, Anti-P450 Blocking Peptide, CPR Blocking Peptide, CYPOR Blocking Peptide, DKFZp686G04235 Blocking Peptide, FLJ26468 Blocking Peptide, P450R Blocking Peptide, Cytochrome Oxidoreductase Blocking Peptide, POR Blocking Peptide, P450, P-450, P 450, P-450 Blocking Peptide, P 450 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
Molecular Weight 77 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors