PA2G4 Blocking Peptide (33R-6656)
A synthetic peptide for use as a blocking control in assays to test for specificity of PA2G4 antibody, catalog no. 20R-1262
Overview
Overview
| Synonyms | PA2G4 control peptide, PA2G4 antibody Blocking Peptide, Anti-PA2G4 Blocking Peptide, proliferation-associated 2G4, 38kDa Blocking Peptide, EBP1 Blocking Peptide, HG4-1 Blocking Peptide, p38-2G4 Blocking Peptide, PA2G4, PAG4-2, PAG4 2, PAG4-2 Blocking Peptide, PAG4 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product