PABPC1L2A antibody (70R-4937)

Rabbit polyclonal PABPC1L2A antibody

Synonyms Polyclonal PABPC1L2A antibody, Anti-PABPC1L2A antibody, PABPC-1 antibody, Poly A binding protein 1-like 2A antibody, PABPC 1, PABPC1, PABPC-1, RBM32A antibody, PABPC 1 antibody
Cross Reactivity Human
Applications WB
Immunogen PABPC1L2A antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
Assay Information PABPC1L2A Blocking Peptide, catalog no. 33R-6710, is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody


Western Blot analysis using PABPC1L2A antibody (70R-4937)

PABPC1L2A antibody (70R-4937) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC1L2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PABPC1L2A may be involved in nucleic acid and nucleotide binding

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PABPC1L2A antibody (70R-4937) | PABPC1L2A antibody (70R-4937) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors