PABPC4 antibody (70R-1415)

Rabbit polyclonal PABPC4 antibody raised against the N terminal of PABPC4

Synonyms Polyclonal PABPC4 antibody, Anti-PABPC4 antibody, Poly A binding protein 4 antibody, PABPC 4, PABPC 4 antibody, PABPC-4, PABPC4, PABPC-4 antibody
Specificity PABPC4 antibody was raised against the N terminal of PABPC4
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS
Assay Information PABPC4 Blocking Peptide, catalog no. 33R-1137, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody


Immunohistochemical staining using PABPC4 antibody (70R-1415)

PABPC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PABPC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PABPC4 antibody (70R-1415) | PABPC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PABPC4 antibody (70R-1415) | PABPC4 antibody (70R-1415) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors