PADI4 Blocking Peptide (33R-9085)

A synthetic peptide for use as a blocking control in assays to test for specificity of PADI4 antibody, catalog no. 70R-3322

Synonyms PADI4 control peptide, PADI4 antibody Blocking Peptide, Anti-PADI4 Blocking Peptide, Peptidyl Arginine Deiminase Type Iv Blocking Peptide, PAD Blocking Peptide, PADI5 Blocking Peptide, PDI4 Blocking Peptide, PDI5 Blocking Peptide, PADI4, PADI-4, PADI 4, PADI-4 Blocking Peptide, PADI 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
Molecular Weight 74 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors