PADI4 Blocking Peptide (33R-9085)
A synthetic peptide for use as a blocking control in assays to test for specificity of PADI4 antibody, catalog no. 70R-3322
Overview
Overview
| Synonyms | PADI4 control peptide, PADI4 antibody Blocking Peptide, Anti-PADI4 Blocking Peptide, Peptidyl Arginine Deiminase Type Iv Blocking Peptide, PAD Blocking Peptide, PADI5 Blocking Peptide, PDI4 Blocking Peptide, PDI5 Blocking Peptide, PADI4, PADI-4, PADI 4, PADI-4 Blocking Peptide, PADI 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL |
|---|---|
| Molecular Weight | 74 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product