PAGE1 antibody (70R-1637)

Rabbit polyclonal PAGE1 antibody

Synonyms Polyclonal PAGE1 antibody, Anti-PAGE1 antibody, GAGE-9 antibody, GAGEB1 antibody, PAGE-1 antibody, PAGE 1, PAGE1, PAGE 1 antibody, PAGE-1 antibody, PAGE-1, P Antigen Family Member 1 antibody
Cross Reactivity Human
Applications WB
Immunogen PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN
Assay Information PAGE1 Blocking Peptide, catalog no. 33R-9148, is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody

Images

Western Blot analysis using PAGE1 antibody (70R-1637)

PAGE1 antibody (70R-1637) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PAGE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAGE1 antibody (70R-1637) | PAGE1 antibody (70R-1637) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors