PANK4 antibody (70R-2711)

Rabbit polyclonal PANK4 antibody raised against the middle region of PANK4

Synonyms Polyclonal PANK4 antibody, Anti-PANK4 antibody, DKFZp547M242 antibody, PANK 4, PANK-4 antibody, Pantothenate Kinase 4 antibody, PANK4, PANK 4 antibody, PANK-4, FLJ10782 antibody
Specificity PANK4 antibody was raised against the middle region of PANK4
Cross Reactivity Human
Applications WB
Immunogen PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD
Assay Information PANK4 Blocking Peptide, catalog no. 33R-4962, is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody

Images

Western Blot analysis using PANK4 antibody (70R-2711)

PANK4 antibody (70R-2711) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PANK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PANK4 antibody (70R-2711) | PANK4 antibody (70R-2711) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors