PAPD4 antibody (70R-2165)

Rabbit polyclonal PAPD4 antibody raised against the N terminal of PAPD4

Synonyms Polyclonal PAPD4 antibody, Anti-PAPD4 antibody, PAPD 4, PAPD4, PAPD-4, FLJ38499 antibody, Pap Associated Domain Containing 4 antibody, PAPD-4 antibody, PAPD 4 antibody
Specificity PAPD4 antibody was raised against the N terminal of PAPD4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PAPD4 antibody was raised using the N terminal of PAPD4 corresponding to a region with amino acids GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT
Assay Information PAPD4 Blocking Peptide, catalog no. 33R-3535, is also available for use as a blocking control in assays to test for specificity of this PAPD4 antibody


Western Blot analysis using PAPD4 antibody (70R-2165)

PAPD4 antibody (70R-2165) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAPD4 is a cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. PAPD4 belongs to the DNA polymerase type-B-like family, GLD2 subfamily.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PAPD4 antibody (70R-2165) | PAPD4 antibody (70R-2165) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors