PAPOLB antibody (70R-4959)

Rabbit polyclonal PAPOLB antibody raised against the N terminal of PAPOLB

Synonyms Polyclonal PAPOLB antibody, Anti-PAPOLB antibody, TPAP antibody, PAPT antibody, Poly A polymerase beta antibody
Specificity PAPOLB antibody was raised against the N terminal of PAPOLB
Cross Reactivity Human
Applications WB
Immunogen PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK
Assay Information PAPOLB Blocking Peptide, catalog no. 33R-9005, is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody


Western Blot analysis using PAPOLB antibody (70R-4959)

PAPOLB antibody (70R-4959) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPOLB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PAPOLB antibody (70R-4959) | PAPOLB antibody (70R-4959) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors