PAPOLB antibody (70R-4960)

Rabbit polyclonal PAPOLB antibody raised against the middle region of PAPOLB

Synonyms Polyclonal PAPOLB antibody, Anti-PAPOLB antibody, TPAP antibody, PAPT antibody, Poly A polymerase beta antibody
Specificity PAPOLB antibody was raised against the middle region of PAPOLB
Cross Reactivity Human
Applications WB
Immunogen PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM
Assay Information PAPOLB Blocking Peptide, catalog no. 33R-5900, is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody

Images

Western Blot analysis using PAPOLB antibody (70R-4960)

PAPOLB antibody (70R-4960) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPOLB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAPOLB antibody (70R-4960) | PAPOLB antibody (70R-4960) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors