PARK7 antibody (70R-5727)

Rabbit polyclonal PARK7 antibody

Synonyms Polyclonal PARK7 antibody, Anti-PARK7 antibody, DJ-1 antibody, FLJ27376 antibody, Parkinson Disease antibody, PARK-7, PARK 7 antibody, PARK-7 antibody, PARK 7, DJ1 antibody, Parkinson disease Autosomal Recessive 7 antibody, PARK7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
Assay Information PARK7 Blocking Peptide, catalog no. 33R-9402, is also available for use as a blocking control in assays to test for specificity of this PARK7 antibody

Images

Western Blot analysis using PARK7 antibody (70R-5727)

PARK7 antibody (70R-5727) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARK7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARK7 antibody (70R-5727) | PARK7 antibody (70R-5727) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors