PARL Blocking Peptide (33R-8594)
A synthetic peptide for use as a blocking control in assays to test for specificity of PARL antibody, catalog no. 70R-6398
Overview
Overview
| Synonyms | PARL control peptide, PARL antibody Blocking Peptide, Anti-PARL Blocking Peptide, Presenilin Associated Rhomboid-Like Blocking Peptide, PRO2207 Blocking Peptide, PSARL Blocking Peptide, PSARL1 Blocking Peptide, PSENIP2 Blocking Peptide, RHBDS1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product