PARL Blocking Peptide (33R-8594)

A synthetic peptide for use as a blocking control in assays to test for specificity of PARL antibody, catalog no. 70R-6398

Synonyms PARL control peptide, PARL antibody Blocking Peptide, Anti-PARL Blocking Peptide, Presenilin Associated Rhomboid-Like Blocking Peptide, PRO2207 Blocking Peptide, PSARL Blocking Peptide, PSARL1 Blocking Peptide, PSENIP2 Blocking Peptide, RHBDS1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors