PAX8 antibody (70R-1960)

Rabbit polyclonal PAX8 antibody raised against the N terminal of PAX8

Synonyms Polyclonal PAX8 antibody, Anti-PAX8 antibody, PAX-8 antibody, PAX8, PAX-8, PAX 8 antibody, PAX 8, Paired Box Gene 8 antibody
Specificity PAX8 antibody was raised against the N terminal of PAX8
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
Assay Information PAX8 Blocking Peptide, catalog no. 33R-4656, is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody

Images

Western blot analysis using PAX8 antibody (70R-1960)

Recommended PAX8 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAX8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using PAX8 antibody (70R-1960) | Recommended PAX8 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors